PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32992.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 375aa    MW: 41992.8 Da    PI: 6.2272
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32992.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093013371955
                 HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +k +yps++++  LA+++gL+++q+ +WF N+R ++
  KHN32992.1 301 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 337
                 45679*****************************885 PP

2ELK41.13.8e-14257278122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK qLlrKYsgyLgsLkqEF+
  KHN32992.1 257 ELKGQLLRKYSGYLGSLKQEFM 278
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.4E-20117161IPR005540KNOX1
PfamPF037902.1E-22118157IPR005540KNOX1
SMARTSM012561.2E-26171222IPR005541KNOX2
PfamPF037913.2E-21174221IPR005541KNOX2
PROSITE profilePS5121311.174257277IPR005539ELK domain
SMARTSM011882.8E-8257278IPR005539ELK domain
PfamPF037896.3E-11257278IPR005539ELK domain
PROSITE profilePS5007113.086277340IPR001356Homeobox domain
SMARTSM003891.2E-12279344IPR001356Homeobox domain
SuperFamilySSF466891.75E-19279355IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-28282342IPR009057Homeodomain-like
CDDcd000861.25E-12289341No hitNo description
PfamPF059206.8E-17297336IPR008422Homeobox KN domain
PROSITE patternPS000270315338IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MEGSSCSNDT SYLLAFGENS GGLCPMTMMP LVTSHHATNP SNPSNNTNNN ENTNCLFIPN  60
CSNSSGTPSI MLHNNNNTDD DNNKTSTNTG LGYYFMESDH HHRNNNNNGS SSSSSSSAVK  120
AKIMAHPHYH RLLAAYVNCQ KVGAPPEVVA RLEEACASAA TMAGDAAAAA GSSCIGEDPA  180
LDQFMEAYCE MLTKYEQELS KPLKEAMLFL QRIECQFKNL TISSTDFACN EGAERNGSSE  240
EDVDLHNMID PQAEDRELKG QLLRKYSGYL GSLKQEFMKK RKKGKLPKEA RQQLLEWWSR  300
HYKWPYPSES QKLALAESTG LDQKQINNWF INQRKRHWKP SEDMQFVVMD PSHPHYYMDN  360
VLGNPFPMDL SHPML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1272281LKQEFMKKRK
2278282KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973910.0BT097391.1 Soybean clone JCVI-FLGm-21P16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242710.10.0uncharacterized protein LOC100805837
SwissprotP466080.0HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0B2RMA10.0A0A0B2RMA1_GLYSO; Homeobox protein SBH1
TrEMBLI1MFK90.0I1MFK9_SOYBN; Uncharacterized protein
STRINGGLYMA15G11850.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-132KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]